PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G156100.1
Common NamePHAVU_008G156100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 397aa    MW: 45397.9 Da    PI: 8.7
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G156100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-16167213148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g W++eEd  lv++vk++G + W+ Ia+ ++ gR +kqc++rw+++l
  Phvul.008G156100.1 167 KGQWSAEEDSVLVQLVKRFGIKKWSHIAKLLN-GRVGKQCRERWHNHL 213
                         799*****************************.*************97 PP

2Myb_DNA-binding61.41.9e-19219261145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + +W++eEd++l++a+k+lG++ W+ Iar+m+ gRt++ +k++w+
  Phvul.008G156100.1 219 KESWSEEEDKILIEAHKELGNK-WAEIARRMP-GRTENTIKNHWN 261
                         578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.933162213IPR017930Myb domain
SuperFamilySSF466891.39E-31164260IPR009057Homeodomain-like
SMARTSM007173.0E-14166215IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-26168219IPR009057Homeodomain-like
CDDcd001672.59E-13170213No hitNo description
PfamPF139215.7E-18170227No hitNo description
PROSITE profilePS5129427.647214268IPR017930Myb domain
SMARTSM007173.6E-17218266IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21220266IPR009057Homeodomain-like
CDDcd001671.53E-13221264No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MEFSPSFPEK IHYLSGIFPE IKSEIPASEE NTSFMYQNNF NHFQHHHHHL NEPNQGHPES  60
FFTEGPSSII NPLFSLSSAN HSSGGPSSYK STYPNESLKG GYANPYYPMP YAPNNTNVES  120
MHGHPNKVIW DFSQKVPLHS GPSATSDPQV QRKTNGQIQH RVTNIIKGQW SAEEDSVLVQ  180
LVKRFGIKKW SHIAKLLNGR VGKQCRERWH NHLRPNIRKE SWSEEEDKIL IEAHKELGNK  240
WAEIARRMPG RTENTIKNHW NATKRRQKAK RQRSKRRSSK GAPTLLESYI RKVTAAEESE  300
KELKNCMSKM NLNETTNAGL FRVRYESSEG DFSSEEEEVG WSLQHHVPCG GDGGYVPLMV  360
NAGEESLIDY EVALQMAPEV QMRKEMDLME MIYRKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-4415326739158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-4415326739158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1263276KRRQKAKRQRSKRR
2267272KAKRQR
3270275RQRSKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140966.10.0hypothetical protein PHAVU_008G156100g
TrEMBLV7B5V30.0V7B5V3_PHAVU; Uncharacterized protein
STRINGGLYMA19G13923.11e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-55myb domain protein 98